SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IIW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IIW7
Domain Number 1 Region: 218-317
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.66e-24
Family Canonical RBD 0.0038
Further Details:      
 
Domain Number 2 Region: 116-212
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.99e-21
Family Canonical RBD 0.0024
Further Details:      
 
Domain Number 3 Region: 610-652
Classification Level Classification E-value
Superfamily WW domain 0.000000000102
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1IIW7
Sequence length 738
Comment (tr|I1IIW7|I1IIW7_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI4G08727.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100836687 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MHRGSDRTGDLPGPAGGARSGGDGRFARGPSRWSGGGGGGGGGGGSPPHRSSSRGGAGDG
GGGGRFHPYRGPSEYSVGTGGSGGYRGGGGGGDFGDTAGGPRNRYGGGGGGGGRGDHSDH
DNKSGYVKLFVGSVPRTANEDDVRPLFADHGDVLEVALIRDRKTGEQQGCCFVKYATSEE
AERAIRALHNQCTIPGAMGPVQVRYADGEKERHGSIEHKLFVASLNKQATAKEIEEIFSP
FGHVEDVYIMKDGMRQSRGCGFVKFSSKEPALAAMNSLSGTYGCEQPLIVRFADPKRPRP
GESRGGPAFGGPGVSPRSDAALVIRPTANLDEPRGRHMPPDSWHPSSPNSMAPHQFNNNF
GSDNHMGLMGGSVASADNAAFRPQMFHGNGSLSTQTALPTSSHMGMNPSISQGHHLGGQQ
ILPLQKAPGPLHNFPVQLQNAQQGQLQQIGQHHVPQSLGPSSLSQHIPAMPLPGQLPVSQ
PLTQQNTSAGALQAPSAVQSNLMQAVPGQQQLTSNVAPQMLQQAMQQMPSQAPQLLLQQQ
AALQSSYQSSQQAIFQLQQQLQLMQQHQQQPNLNQQPHTQVPKQQGQPMVQSSTPGALAA
VVPTNINAIPQQVNSSAVSLTCNWTEHTSPEGFKYYYNSMTRESKWEKPEEYLLYEQQQQ
QQHQKLILLQQHQQKLAAQQLQSPPQAQTIPTMQSIQQHPQPLQGQTQMQMKQQATGSID
PSRIQQGIQAAQERSWKN
Download sequence
Identical sequences I1IIW7
EG:BRADI4G08727.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]