SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IJL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IJL2
Domain Number 1 Region: 12-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-65
Family WD40-repeat 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1IJL2
Sequence length 322
Comment (tr|I1IJL2|I1IJL2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ87404.1, ECO:0000313|EnsemblPlants:BRADI4G10930.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_4g10930v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MKLAGLKSVDGAHEESVWAAAWAPAAEHRPTALLLTGALDETVRAWRADDLAAASPPARG
HALGVVSLAAHPAGVIAAAVSLDSYIRVFDVDSGASVATLDAPPSEVWGVQFHPKGVALA
AAGGGSGSVKLWDTEKWQPIASLPVPRPEGARPDKTGSGKFVLSVAWSPDGKLLACGSMD
GTIAVYDAVRMKFLHHLEGHHMPVRSMVFSPVDPHVLFTACDDAHIHIYDAKEKGLIGAM
SGHASWVLSIDVSPDGMAVATGSSDRTVRLWDINARASVQTMSNHSDQVWAVAFRPPGGE
GVRAGRLASASDDKSISLYDYS
Download sequence
Identical sequences I1IJL2
15368.BRADI4G10930.1 XP_003577267.1.954 EG:BRADI4G10930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]