SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IKA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IKA7
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000028
Family Ankyrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1IKA7
Sequence length 94
Comment (tr|I1IKA7|I1IKA7_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI4G13440.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MVGSLKCVKLLLEAGADVDGNCKETPLMFAASNGGFTDILKCLVLVGADANVLDSLGRAP
IEIGSCSGRRKDVEILFPVTSHIPSIRDWSADGI
Download sequence
Identical sequences I1IKA7
EG:BRADI4G13440.1 15368.BRADI4G13440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]