SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IL77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IL77
Domain Number 1 Region: 8-244
Classification Level Classification E-value
Superfamily 14-3-3 protein 3.27e-102
Family 14-3-3 protein 0.00000000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1IL77
Sequence length 266
Comment (tr|I1IL77|I1IL77_BRADI) GF14f protein {ECO:0000313|EMBL:AOZ21338.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_4g16640v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MSPAEPTREESVYMAKLAEQAERYEEMVEFMERVAKATGGAGPGEELSVEERNLLSVAYK
NVIGARRASWRIISSIEQKEEGRGNESHAATIRTYRSKIEAELAKICDGILALLDSHLVP
SAGAAESKVFYLKMKGDYHRYLAEFKSGAERKEAAESTMNAYKAAQDIALADLAPTHPIR
LGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLRDNLTL
WTSDTNEDGGDEIKEAPAPKESGDGQ
Download sequence
Identical sequences I1IL77
15368.BRADI4G16640.1 XP_003577480.1.954 EG:BRADI4G16640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]