SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IML9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IML9
Domain Number 1 Region: 547-758
Classification Level Classification E-value
Superfamily ARM repeat 2.07e-29
Family Armadillo repeat 0.024
Further Details:      
 
Domain Number 2 Region: 450-528
Classification Level Classification E-value
Superfamily RING/U-box 1.56e-25
Family U-box 0.00035
Further Details:      
 
Domain Number 3 Region: 23-156,258-304
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.43e-19
Family Protein kinases, catalytic subunit 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1IML9
Sequence length 768
Comment (tr|I1IML9|I1IML9_BRADI) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00702733} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAMRNDIWEKKLQDPSAIPMFLPLEFLKAITGDFSTEQELGRGGYGVVYKGILRSGKSIA
VKKLFDLHVLEDNKFQREHLLFILAMPQLFKLCCSGYMAPEYLIQGIVSIKADIFSFGVI
IIEILTGCRDYPLSVVPDSQDFIEKDSPKSTNTSFQHFKAKSRRGPGEGDWRRRRVVVEV
KLGRQKWRSQAPGLRAQISGEDGRSERIQAAEAPCGGSSVVEATSRGGGGGSAIRQILDI
WRNRLQISLGDTLLEQIRICAEIGIQCIQFKPGKRPVTQHIIDMLDEVNIINGSIKPDMS
TPAAVQVLENEKIMKISQDIALRIEQVLDGISFDEPGISDKVREQIELIHIQLKRAKELS
DSSDGDLFNGLMSVYNSSTNATGSDQDIHRGLSEKLQLVTISDLSEESLALHEMSIRADP
AAVVEKMSMLLKKIKDFAQALVPASLTGTSSKDNSTSAVIPDAFRCPISLCLMEDPVMVS
TGQTYERASIAKWFKAGNDTCPTTQQKLVNKSLTPNYALHGLIVQWCELYCLELEPPKRP
VEVSSIIEHNRVTELLQKLSSQNLLDQRGAAGTLRQFARRNTESCARIGDSGGIPVLMGL
LSTTDVSTQEHVVTALLNVSIHDENKMRIVSSGAIPGLVEGNKGKAVTAGLVPVLLELLK
GAQDGIPDEAIALLSILSINPEEKAAIIAGDAIPSLCEVIRNESPRNKENAANILVHLCS
GEQHQHLAEAQQQGVVPSLVELARSGTDRAKRKAIQLLEWNKENNGVT
Download sequence
Identical sequences I1IML9
EG:BRADI4G22590.1 15368.BRADI4G22590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]