SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IMN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IMN4
Domain Number 1 Region: 636-712,935-1198
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-79
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000787
Further Details:      
 
Domain Number 2 Region: 59-129
Classification Level Classification E-value
Superfamily ARM repeat 0.00000104
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1IMN4
Sequence length 1205
Comment (tr|I1IMN4|I1IMN4_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ89004.1, ECO:0000313|EnsemblPlants:BRADI4G22690.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_4g22690v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MVRLLGLRGLSFGPEESPREITAAGGDAAPPVGSSGWLVRFFDSAFFCEWIAVSYLYKHD
HAGVRDYLCNRMYTLPLPGLEAYLFQVCYMLVHKPSPSLDRFVIDTCAKSLRIALKVHWI
LAAELELEETEDLDGIDKVQEQCQAAATVQGEWPPLVRPAPLSPVASPRGNPMLSRIRSS
KQRLMSLASSPSLGLSPTGGGTNVPATDDAGVGRGKQPVMPSSEDNRLLRRLSIGPKVVR
DALFSKRSMEKDEEQDKDGFFKRLLRDSKDKEEDDGDKEGFFKRLLKDSKEKENEEEEGD
KDGFFRRLLRDSKDEDMELTPSSDGLLKRLFRDKEDRQGDDEEKEGLFRRIFKDKNEDRR
ESMHGKHGDEEKLGKSLEDDDREGFFRKIFKDKNEERKDGGSQKQHDGREKVGASTEEEK
KDGFFRQLFKEKIDEKKEGTTPSKKEDDDKGNKSIDEDNFFRRIFKDKNEEKKGGAHYRN
EDDKFEEGDKENFFRKLFKDKHEGRRIEGFDKNDDDGRSTSGIEEEENSEFLSFRRLFRV
HPEDAKSGHIEGSHPSGISEGSPGSESFFKRLFRDRDRSLEDSELLTSKLLKEKYPDSTG
NSEKQSGKPPLPNNVIAELRKGSYYASLELVQSLCDTSYGLVDIFPVEDRKIALLESLTE
INSHIASSEKNGGVCFPMGKGICRVVHIPEDESVLLNSREKAPYLICVEVLKAETPSHSK
GSSDVNKLSKGGIPLANGDVQLPKPPPWAYPLWSRHETQNYETDRMLNSTSQVIDQAMAQ
LWEAKVKFVNVSFSIEKIGRSRSIAMSESGRRRQATTDPRDPWEDSQAIVDQPIEWVKVT
LSAVPGVSMEDVDDNEPTRKKDHRRVPSTIAMEEVKAAALKGEAPPGLPLKGVGQSTQNL
DSKATDGGDPKPTDALAGELWTVKKERIRRSSVHGRLPGWDLRSIIVKSGDDCRQEHLAV
QLVAHFYDIYQEAGLPLWLRPYEVIVTSAYAALIETIPDTASIHSIKSRFPNISSLRDYY
VAKYEENSPNFKLAQRNFVESMAGYSILSYLLQIKDRHNGNLLIDEEGHIIHIDFGFMLS
NSPGGVNFESAPFKLTRELLEVMDSDAEGTPSEFFDYFKVLCIQGFLTCRKHAERVILLV
EMLQDSGFPCFKGGTRTILNLRKRFHLSLTEEQCVSLVLSLISSSMDAWRTRQYDYYQRV
LNGIL
Download sequence
Identical sequences I1IMN4
EG:BRADI4G22690.1 15368.BRADI4G22690.1 XP_010237850.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]