SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1IS97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IS97
Domain Number 1 Region: 33-196
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.31e-60
Family Cyclophilin (peptidylprolyl isomerase) 0.00000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1IS97
Sequence length 206
Comment (tr|I1IS97|I1IS97_BRADI) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363019} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100832088 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MLRKVAGVFLACAALYLAFSSYVRRERIADVQLPAVTHRVYLDVEIDGQNIGRIVIGLYG
EVVPKTVENFRALCTGEKGVGPKGKSLHYKGTPFHRIIPGFMIQGGDIVRGDGKGSESIY
GGTFPDENFSVKHTHPGVVAMANSGTDSNGSQFYITTIKTFWVIQGMDYVYAIEGGAGTY
NGKPRKKALITDSGEIPKEKWGEEIQ
Download sequence
Identical sequences I1IS97
EG:BRADI4G36430.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]