SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1ISF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1ISF3
Domain Number 1 Region: 287-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-74
Family Protein kinases, catalytic subunit 0.0000109
Further Details:      
 
Domain Number 2 Region: 195-268
Classification Level Classification E-value
Superfamily ACT-like 0.000000000958
Family IlvH-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1ISF3
Sequence length 526
Comment (tr|I1ISF3|I1ISF3_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI4G36880.4} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=LOC100843406 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MAVEEAAESCGSHAAAAASRGGAGSSSPPAASGAQSRKHQQQQRHKLEVYTEVLRRLHDA
GIPEEQSPGFEDELWSHFNRLPARYAMDVNVERAEDVLTHKRLLEQAKDPAQRPAFAVRA
VQVSPILDGNQTDADSNTAGEEVASRLLNRQQSIHPPPAFGSSTNLEALALEASKSQGQD
HDSTSDNVRSLYRPMHEITFSTIDKPKLLSELTCLLGELGLNIQEAHAFSTNDGYSLDVF
VVVGWHAEETEDLVEEVKKEISKIEETQAWSSSHSWSSPVDNMQIVENSAPDHVEIPTDG
ASEWEIDVKLLNFGNKVASGSYGDLYRGTYCSQDVAIKVLKPERVNADMQREFAQEVYIM
RKVRHKNVVQFIGACTKPPRLCIVTEYMSGGSVYDYLHKHKGVFKLPALVGVAIDVSKGM
SYLHQNNIIHRDLKTANLLMDENGMVKVADFGVARVKVQSGVMTAETGTYRWMAPEVIEH
KPYDHKADVFSFGILMWELLTGKIPYEYLTPLQAAVGVVQKVKLCC
Download sequence
Identical sequences I1ISF3
EG:BRADI4G36880.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]