SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1ITB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1ITB3
Domain Number 1 Region: 7-167,271-438
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.65e-115
Family Eukaryotic glutathione synthetase ATP-binding domain 0.000003
Further Details:      
 
Domain Number 2 Region: 170-273
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.2e-35
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1ITB3
Sequence length 439
Comment (tr|I1ITB3|I1ITB3_BRADI) Glutathione synthetase {ECO:0000256|PIRNR:PIRNR001558} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_4g39310v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MSARSGKAPGVGLLHAPFALLPMSFPKVYWEQALELAPLFNELVHRVSLDGEFLQQTLAR
TKEADSFTRRLLEIHSKMMEINKKEEIQLGLTRSDYMVDGATDRLLQVELNTISTSSNGL
ACGVCELHRNLIRHHERELGLDPSGVVGNTAITQHAEALASAWAEYNNQRAVVVVVVQAE
ERYMYDQYWITVALREMYGVTTVRKTMAEIEVEGELRPDGTLVINGSPVAVVYLRAGYSP
NDYPSEAEWRARLLIERSSAIKCPSIAHHLVGTKKIQQELAKENVLERFLDNKSDIEKVR
KCFAGLWSLENDSIVRSAIESPELFVLKPQREGGGNNIYGDNLRETLIRLRRGGSNEIAA
YILMQRIFPPASLSYLVREGICVRENAVSEFGVFGAYLRNKDKVIINDQCGYLLRTKAAS
LNEGGVVAGFAFLNCIFLS
Download sequence
Identical sequences I1ITB3
15368.BRADI4G39310.1 XP_010238571.1.954 EG:BRADI4G39310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]