SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1ITS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1ITS2
Domain Number 1 Region: 67-517
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.31e-65
Family Cystathionine synthase-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1ITS2
Sequence length 624
Comment (tr|I1ITS2|I1ITS2_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ91940.1, ECO:0000313|EnsemblPlants:BRADI4G40700.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_4g40700v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MPSLPDAAPAPSVTPADPTADAMSAATLLHLIGATEATSSDSKISWLRSQLIGKDAEFYT
PFGRRLLTYADQTASGRSLHYIEDYILNEVLPFYGNTHTEDSHVGGKTTRLVHKAARYVK
RCTGAGPGDALIFSGAGATAAIKRLQELIGVSPPCGAGTRERVKAGMREEERWVVFVGPY
EHHSNLLSWRQSLAEVVEIGVDEDGLVDVGALRRALGSPEYANRPMLGSFSACSNVTGIL
TDTRELARVLHQHGAFACFDFAASGPYVKIDMKSGEIDGYDAVFLSPHKFVGGPGTPGIL
LMNKSLYRLNAQPPSTCGGGTVAYVNGFNEEDTLYYEDIEEREDAGTPPIIQKIRASLAF
WVKEYIGYDTMGLRERVYSEMAMKRLLQNPNVKVLGNTSVHRLPIFSFLIYPSLTDKLSG
QPVSDTLLENARRKQLPLHGRFVTRLLNDLFGIQARGGCACAGPYGHILLNVDNELSLHI
RSAILKGYSGLKPGWTRLSFSYYLSKEEFRFILSAIEFVAAYGHRFLPLYRFDWISGSWT
FRKQAVKYHIMMEELSLGTEVSKLQNDQQAKVADKLDMKTEAGHSKFERYLESAKKIALS
LPDVSNQIVSIPKGVDPDLVLFHV
Download sequence
Identical sequences I1ITS2
EG:BRADI4G40700.1 15368.BRADI4G40700.1 XP_010239477.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]