SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1IUA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1IUA8
Domain Number 1 Region: 555-843
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-74
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1IUA8
Sequence length 906
Comment (tr|I1IUA8|I1IUA8_BRADI) Uncharacterized protein {ECO:0000313|EnsemblPlants:BRADI4G42360.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN= OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MRSKSFLPLLLLCLAMAAAASRSSAAAASGVAAVGGGGLMHIPTAADLAHCPSRCGDVDI
MYPFGVGPGCFRQGFELTCHNNKLFLGNSNAQIQYLYYKFVEASVDLSIDMRPGMDTYNL
SWPEDPIEGVTISGRSFLYVVGCGVDAYLFDHDTNDIIGFCMSICLDDREAMEKDDADAL
GDPVDSSMGCNGKGCCSIGLKRDRRALALRIGRLRDGSGNTMAQSDDRVLSKVKVFLSQE
YKFQMSDLYSNRINGTKKGQHFEVAMTDQRSCASAQMNRSSYACNNKSTCVDRQSGGGYS
CWCRNQGNPYTVDGCTVGYQPNPKRKNCKRSCGHTRILFPFGIEEGCYALEKFRLNCTEK
NITVLDRGVQYLVDNVSMNEGYLSVRKTKFLDISNSNDELEVATTLAENGTMTEEYDYPL
QDLFDLIKEDDMKMWWAVENFTCPMVMSKEYIDIYACRANSYCLNVTRVNSVMQLGYRCK
CSEGYEGNPYTPHGCTAIAIGIGCGLVATILALGTNALVNRWKTGIQKRVRRAHFKKNQG
LLLEQLILDKGATDKTKIFSLDELDKATDNFDATRVLGRGGHGTVYKGILSDQHVVAIKK
SKMVEQVEIDQFINEVAILSQIIHRNVVKLFGCCLEAEVPLLVYEFISNGTLYDLLHNDL
GVKCLLSCDDRIRIAVEAAGALAYLHSAAAIPIFHRDVKSSNVLLDGNFTTKVSDFGASR
SLSLDETHVVTIVQGTFGYLDPEYYHTGQLTEKSDVYSFGVILVELLTRKKPIFINNVGT
KQSLSHYFVERLVQGGLMEIMDLQVVEEANQEEIDDIASVAEACLRTKGGERPTMKEVEM
RLQILRTTRLRRNQLASRKGGEIEPFLCPDTNSSDAHTNYTGTIDVPSSCMSGMYSLEQE
FASLPR
Download sequence
Identical sequences I1IUA8
15368.BRADI4G42360.1 EG:BRADI4G42360.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]