SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1J015 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1J015
Domain Number - Region: 113-207
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000602
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1J015
Sequence length 221
Comment (tr|I1J015|I1J015_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ83763.1, ECO:0000313|EnsemblPlants:BRADI5G16730.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_5g16730v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MIQLLFTLLAAEAGLVLVLLFRTPARRLALLAVDRSKRGRGPIMARTVAATMFMVLGSSG
YSIAKIRRREGDFAQLTPTDQVLASRHLLEASLMGYSLFLGLVIDRLHHYIRQIRTMKKS
MEAVTKQSKTLEEAKLQGAEEIQGYQKKISSLNEQVQAVKHQYETKTEELKTAEANTLAL
RKQSEGLLTEYERLIAENEELRNKLQSMEVRFSHSDGKKNS
Download sequence
Identical sequences I1J015
EG:BRADI5G16730.1 XP_003580219.1.954 15368.BRADI5G16730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]