SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1J1J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I1J1J4
Domain Number - Region: 98-182
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.0068
Further Details:      
 
Domain Number - Region: 38-66
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0902
Family PspA lactotransferrin-binding region 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1J1J4
Sequence length 331
Comment (tr|I1J1J4|I1J1J4_BRADI) Uncharacterized protein {ECO:0000313|EMBL:KQJ84455.1, ECO:0000313|EnsemblPlants:BRADI5G20990.1} KW=Complete proteome; Reference proteome OX=15368 OS=Brachypodium distachyon (Purple false brome) (Trachynia distachya). GN=BRADI_5g20990v3 OC=Pooideae; Brachypodieae; Brachypodium.
Sequence
MASHGALPIAFAVLLCSSFLLTQCTVVAASVSSLSSHEQEQEQEIRRLRSKVASLEDEVS
GRKEETSQLESLVREKTAQIAALVGGLEVLQVTNVADDESVMKASTNSAMLEEQIERLGN
DLEDQVKKGESLEARASEAEKSLLELGQKLEHVEKINIEQRKKIEELEHHLQNAEGQLSE
GQTEAKLKAEELAMDRGMWLPYWFASRSEHCQELASVKWRLHGKPAVDALMQKVVRTLTH
AQRLVEPHLQATQNVQEGIRRFLLDNELLKLNPLSAHRLAWWTASAALFALPVYFVYKIF
SATIWKKIQARGNRGRGGRFSRRKPARRVGK
Download sequence
Identical sequences I1J1J4
XP_003581624.1.954 EG:BRADI5G20990.1 15368.BRADI5G20990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]