SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1K6T2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1K6T2
Domain Number 1 Region: 156-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-40
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 736-802
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000108
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1K6T2
Sequence length 802
Comment (tr|I1K6T2|I1K6T2_SOYBN) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_05G200800 OC=Phaseoleae; Glycine; Soja.
Sequence
MATSEVSIKGNSVNGKGDNSSGGYTNDVRNGSGGGEARNSSSSSSSARDAEAALYRELWH
ACAGPLVTVPREGERVFYFPQGHIEQVEASTNQVAEQHMPVYDLPPKILCRVINVMLKAE
PDTDEVFAQVTLLPEPNQDENAVEKEGPPAAPPRFHVHSFCKTLTASDTSTHGGFSVLRR
HADECLPPLDMTKQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVA
GDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAILTGTMFTVYY
KPRTSPAEFIVPYDQYMESLKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDADTKRWP
KSKWRSLKVRWDETSNIPRPERVSQWKIEPALAPPALNPLPMPRPKRPRSNVVPSSPDSS
VLTREASSKVSVDPLPTSGFQRVLQGQELSTLRGNFAESNESDTVEKSAVWPPVADDEKI
DVSTSRRYGSDSWMSMGRHELTYPDLLSGFGTHGDHSSHPSFVDQNGPVANVGRKHLLDC
EGKHNVLSPWSGVPSSLSLNLLDSNTKGSAQGGDTTYQVRGNLRYSSAFGEYPMLHGHKV
EHSHGNFLMPPPPSTPYESPRSRELLPKPISGKPCEVSKPKDSDCKLFGISLLSSPIAPE
PSVSQRNVPSEPVGHMHTTSHQQRAFDNDQKSEHSRGGSKPADGLLIDDHEKVLQTSQTH
LKDIQAKSHSGSARSCTKVHKKGIALGRSVDLTKFSDYGELIAELDQLFEFGGLLTSPQK
DWLIVYTDNEGDMMLVGDDPWQ
Download sequence
Identical sequences I1K6T2
Glyma05g38540.3|PACid:16261170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]