SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1NY93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1NY93
Domain Number 1 Region: 10-79
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000392
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1NY93
Sequence length 111
Comment (tr|I1NY93|I1NY93_ORYGL) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA02G0069900.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAAAAEQNVPVEFQEAHGYAAREKVVLRMLGRSWTVRLKHTKGRRPRRERAVLRYGWHR
FCADNGLAVGDTCFFRALRSAGSGAGDVDDGDGDHVLSVTVHKADGGDPLE
Download sequence
Identical sequences I1NY93
ORGLA02G0069900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]