SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1PXX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1PXX9
Domain Number 1 Region: 136-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-43
Family B3 DNA binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I1PXX9
Sequence length 712
Comment (tr|I1PXX9|I1PXX9_ORYGL) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN=9268260 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MTGIDLNTVEEDEEEAAEEVAANGSSPAPARAGAVCLELWHACAGPVAPLPRKGGVVVYL
PQGHLEHLGDASAAAAAAAAVPPHVFCRVVDVTLLADAATDEVYAQLSLVPEKEEVARRA
DDGEGEDGDGMKQRFARMPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQ
ELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGELRLGV
RRAAQLKNGSAFPALYNQCSNLGTLANVAHAVATESVFNIYYNPRLSQSEFIVPYWKFMK
SLSQPFSVGLRFKMRYESEDATERRYTGIITGSGDTDPMWHGSKWKCLLVRWDDDAEFRR
PNRVSPWEIELTSSVSGSHLSTPHSKRLKPCLPHVNPEYMVPRGGGCPDFAESAQFHKVL
QGQELLGFKSHGGTAAATSQPCEARHLQYIDERSCSSDASNSILGVPRLVDRAPLGNPGF
SYHCSGFGESQRLQKVLQGQELFRPYRGTLVDASMGSNGFHQQDSPRAPGVVNKWQAQLH
GRAAFHGPPAPALPSQSSSPPSVLMFQQANSKMPRLEFGHGQLDKHENDRRVRFGPSEGI
ERREQRIPLQPYPTSGEVIDGQVTVEKSHSPGRHGKDGPDNKAVGTNSCKIFGISLTEKV
PAREELDDGDANYSLQSLKQVPKSLGNSCATVHEQRPVVGRVIDISTMDMMI
Download sequence
Identical sequences I1PXX9
ORGLA05G0222700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]