SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1PYW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1PYW8
Domain Number 1 Region: 66-141
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.19e-21
Family Skp1 dimerisation domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 12-52
Classification Level Classification E-value
Superfamily POZ domain 0.000000432
Family BTB/POZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1PYW8
Sequence length 143
Comment (tr|I1PYW8|I1PYW8_ORYGL) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA06G0008000.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAAEEKKKKKIIKVMSSDGETFEMTEAAASMSPNVAAKPLAKIIEYCTKHAAVEGGSTA
AAAAELKRFDEELIDVDTDTLYHLLMAGNLMGVEGVLELAVQRTAELIRGKSPEEIRDTF
KIANDFTPEEEEEIINENAWALQ
Download sequence
Identical sequences I1PYW8
ORGLA06G0008000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]