SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1QRQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1QRQ9
Domain Number 1 Region: 88-163
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-24
Family Skp1 dimerisation domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 15-75
Classification Level Classification E-value
Superfamily POZ domain 7.22e-19
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I1QRQ9
Sequence length 166
Comment (tr|I1QRQ9|I1QRQ9_ORYGL) Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA09G0173800.1} KW=Complete proteome; Reference proteome OX=4538 OS=Oryza glaberrima (African rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MASAAAADVAADGKKMILLVSSDGVKFELSEAAASLSKTLGNMIEDDCATNGAIPLANVA
SDILAKVVEYCNKHAAAAAAKASGEEELRRFDAEFVNIDRKKLFGLINAANFLDMPCLLE
LTCQRAADFIKDMMPEQVRKVFGIENDFTPEEEAEVRNENAWAYEI
Download sequence
Identical sequences I1QRQ9
ORGLA09G0173800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]