SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1ZLG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1ZLG3
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.18e-52
Family ADP-ribosylglycohydrolase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1ZLG3
Sequence length 284
Comment (tr|I1ZLG3|I1ZLG3_STRPA) ADP-ribosylglycohydrolase {ECO:0000313|EMBL:AFJ25887.1} KW=Complete proteome OX=1114965 OS=Streptococcus parasanguinis FW213. GN=Spaf_0886 OC=Streptococcus.
Sequence
MLGAIVGDIVGSVYEWSNIKTKDFPLFREDCFFTDDTVMTCAVAEAIMNGGQKDDFIDAM
KKYGRMYPDAGYGARFNTWVQSNDCSPYNSFGNGSAMRVSPCAWVMDCGFCARTGTWPSS
RNLVRISAEVTHNHPEGIKGAMATSDAIFLCRYYFGGYCGDYEQPINDHPTECKRRIKEY
IEKEYGYNLSQSLDDIRPNYHFNETCQDTVPQAIIAFLESTDFEDAIRNAISLGGDSDTL
AAITGSIAEAAYGIPDWIKDKAYTYLDDPLKDVLSRWEQEVSIT
Download sequence
Identical sequences I1ZLG3
gi|387879398|ref|YP_006309701.1| WP_014713198.1.15754 WP_014713198.1.25520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]