SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I2C9R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I2C9R1
Domain Number 1 Region: 19-193
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.05e-46
Family N-acetyl transferase, NAT 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I2C9R1
Sequence length 198
Comment (tr|I2C9R1|I2C9R1_BACAM) Ribosomal-protein-alanine N-acetyltransferase {ECO:0000313|EMBL:AFJ63385.1} KW=Complete proteome OX=1126211 OS=Bacillus amyloliquefaciens Y2. GN=MUS_3514 OC=Bacillus amyloliquefaciens group.
Sequence
MGERQLKNVSDQNKRTAMHMQEGNSVDIRPLSLNDAEQELVLQTENRMFFERFAMSRQED
FYTLEGRKKRIEQSLKNAENDTEYSFGIFLQDQTLIGTISLFQVVRGSLQSAFIGYFLDG
KHNGKGYATKAVKLAVDYAFNELKLHRIEAGVMPHNKASIRVLEKAGFHKEGIARKNVKI
NGKWEDHQVLAIIHPEDT
Download sequence
Identical sequences I2C9R1
gi|387899814|ref|YP_006330110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]