SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3IXC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IXC6
Domain Number 1 Region: 274-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.06e-63
Family Extended AAA-ATPase domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 839-953
Classification Level Classification E-value
Superfamily Bromodomain 2.49e-26
Family Bromodomain 0.00099
Further Details:      
 
Domain Number 3 Region: 641-891
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000101
Family Extended AAA-ATPase domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3IXC6
Sequence length 1355
Comment (tr|I3IXC6|I3IXC6_ORENI) ATPase family, AAA domain containing 2B {ECO:0000313|Ensembl:ENSONIP00000001266} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=atad2b OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MQNGHAHMSHRNDESGGGDHSHMNGHVELKRSCRVKKSQFEHLNQSLLFDQLVNSTAEAV
LQEMDNISSIRQNREVERLRMWTGETEEENMDMYSRVKRRKSMRRSTFNMPAHHKVMGKT
EEEEEGTEESHGEEEEEDAEDDDEDDEGDEAEEAGEENDRPYNLRQRKTVQRYEAPPIEP
VNRKQSNPSLFDTHRSPARRSHIRVKKHAIHSSDTTSSSDEERFERRKSKSMTRARNRCL
PMNLTAEDLASGVLRDRVKVGASLADVDPMNLDPSVRFDNVGGLRNHIQSLKEMVVFPLL
YPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSHGDRKVSFFMRKGADCLSKWVG
ESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSKQDQIHSSIVSTLLALMDGLDSRGE
IVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKKARKHILEIHTRDWNPKLSEPFLDEL
AEKCVGYCGADIKALCTEAALMALRRRYPQIYGSSVKLKLDVASIVLGPGDFSKAMRTIV
PASQRALAPPGRALSPTLRPLLATSFSLVLKALLRVFPHAQCTDRDNTHVLGGDNHLLEE
DLYSDDDNEDGSASIYEVQPAASPKSQLTSSAMHRPFLHFSSSALQQPTAYRPRLLLAGA
PSSGQSSHLAPALLHHLDKLPVHRLDLPTLYSVSAKTPEESCAQVFREARRSVPSVVYMP
HISEWWDTVSDTVKSTFLTLLQDVPSFCPVLVLATAETHYSKLSDEVRSIFQRTYGEVVA
LSPPGEEEIRHFFSDLLLVQAARPPPRLRNADKCEEVLPVAEAPGPRVLSAEEQRRLAEQ
EENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIRQPMDLSTVMTKIDTH
QYLTAKDFLVDIDLICSNALEYNPDKDPGDKVIRHRACSLKDTAHAIFAAELDPEFDRMC
EEIKEARRKRDLLTPAQLSAVPGAGATRKHHSVGEEQPRSSTQGDATEKHCTTNHVKRKV
RRRPSWGRGIIRKKKNYKKGTEEEEEEPEAEVEAAGPSDSCLTQDEESSCDITGPQPNGH
HPHVPSTEEESSNEPPVAAPDKSPDASEAREAPMPKVEEPAAKEAEPEITGKHTEPHCLG
GSSQPNIDGDNEASRAHFQPLIEMSVSSDAEDQPKHTEVLLVSQVDCVNGNESMDSLDLQ
SLKGSSEAETRTPQSTAEGSNRAEQDEHKDKNESKPTQEQHPQDGVAVTETVEEDHNKEV
GTFNSSSSEQLKESAERTEEEPQAVPPHPPVVIDHQRLLALLDMVVKKSEGYSVEQLERL
YSLLSQCIYKHRREYDKTQLLEEMEERIQRFDTFL
Download sequence
Identical sequences I3IXC6
ENSONIP00000001266 ENSONIP00000001266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]