SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3IYS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3IYS1
Domain Number 1 Region: 799-921,1017-1308,1352-1392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.61e-56
Family Tandem AAA-ATPase domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3IYS1
Sequence length 1471
Comment (tr|I3IYS1|I3IYS1_ORENI) Aquarius intron-binding spliceosomal factor {ECO:0000313|Ensembl:ENSONIP00000001761} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=aqr OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MEKETPAKKAATPSVSQINAEYVTQLANKYWAPHAKNKLPFDPKVMEDVYEKEILNSKFA
IRKIMLLEFSQYLENYLWVNYTPEVSSNAYIMSICCIVNEKFRENVPAWEVFKKEPHHFP
FFFKCVMEAVLADEQAGLTLKEQTVLLVFMDHCFNSLEVDLIREQVQQLISLPMWMCLLP
SRLQHELKKVPKLQKFWNLIKKKLDKMDADAAEQAEKERTFLSALIKKFHGVLASIPPTG
PASMDQVHYSERFIELMIDLEALLPTRRWFNTVLDDSHLVVRCHLSSLTKREKEGHLFCQ
LLDMLKFYTGFEINDQTGNALTQKEMTTLHYDKITSLQRAAFAHFPELHDFALSSVASVD
TRESLTKHFGHLSPNMLHKVASYLCLLPELPEGQDTTIEKEVLLELLVSRHERRISQIEQ
LNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDVIWRMKPWQSEYGGVVFGGWARMAQPITSFSIVEVAKPNIGESWPARVRADVT
INLNVQDHIKHEWEGLRKHDVCFLITVRPMLLYGTRFDRRQPFVDQTGLVYVRGCEVQGM
LDDKGRVIEEGPEPKPKLRGDVRTFRVWLDPNQYQQDMTSSIQSNTEDPYETFNIIMRRK
PKENNFKAVLETIRHLMNTECVVPDWLHDIILGYGDPGSAHYSKMPNQISTLDFNDTFLS
LDHLRSCFPGNTIKVTEENPELQVPPFSCTRITFPTSNTADKGKKRKADEEVENKEEDKT
LIVEPYVTPNRGPYPYNQPKRNTIPFTSTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQI
ISNLYHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYG
RVNYVLARRLELLREVGRLQESLDVPGDVSYTCETAGHFYLYQVISRWEEYMSKVKPKQG
KNVEVEAVAAHFPFHKYFSNAPQPVFKGRSYEEDMDIAEGCYRHIKKIFTQLEEFRAFEL
LRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVELGFKYDNILMEEAAQILEIETFIPL
LLQNPEDGYSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRLGVPTIDLDAQ
GRARASLCNLYNWRYKHLGNLPHVQQLPEFQVPNPGLTFDFQLINVEDFNGVGESEPNPY
FYQNLAEAEYCVALYMYMRLLGYPAERISILTTYNGQKHLIRDVINQRCAGNPVFGQPHK
ITTVDRFQGQQNDYIILSLVRTKAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFEL
TPAFNQLTARPLQLHIRPHEYYNQEQPRDTSGQPDQIVKSMPEMANLVYNMYMHMIQTSQ
QYRQQQQELALPPKQTQKDAGALSTTATSKEPQEETPMEQENPEGTASTEPNSEDAGEKE
GNKDTDGHAKMPEHPGRDSDSDGESADEQEQ
Download sequence
Identical sequences I3IYS1
ENSONIP00000001761 ENSONIP00000001761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]