SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3J059 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J059
Domain Number 1 Region: 678-803
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-38
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 994-1093
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-29
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 19-100
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 939-1008
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000384
Family UBX domain 0.041
Further Details:      
 
Domain Number 5 Region: 198-311
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000129
Family Phosphotyrosine-binding domain (PTB) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3J059
Sequence length 1295
Comment (tr|I3J059|I3J059_ORENI) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSONIP00000002249} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100692579 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
IQGQPEGARRRLDMNASGEFKSVEVIRGRAGYGFTISGQRPCMLSGILEGSPAYLVGLRQ
GDCIMVINGSDVSTASHEAVVQLIGSCKGPLCLVVQAEGRVMGNPILNDVKFGFAQKSGA
FQKASVFRTVSDDSSNSSFNASCSVAAKQRPVSEPDMSQWSRQWSALAEQPREETSTSGD
ADSVITDEANPDWGVLNMTLVVGYLSSTELILNTSESEDCSKAILERIRQLGTEQDTHTL
VMMKIMFDCIRLCDDAGAVLAAFPAENLVLGAVCTEDPRFFCLVTTGHIINGRVPEDSPL
CASCHVFFIDPELGNHKDHTGIAGRFGFNCTPDPDTSGCLEFPQTPPDVLNFVTVLYSDM
GEAVERLRVKLDAEAQEHAKENVSTAKRGSASSNGDSGIGNASPPEERADRDFPSVIQNH
PGAHLPSCPWDYPPAEGLTPITLSKNGQKLNPENTTSTDSLSESLPGPDSLVSFYGGPPP
RLQFQFKPPPPLMCLDKKTNFSGDPLRGSQRWFSKPKWPKVLSSDPAPCETSNNNWPSHN
SLSASTNNLPPPMSQIPSERYQSAEVMMLPPREEWTRKFVEQRQKQQKDGNTRNVKRAKI
SEKKGSRFWGIGAIRASKRRSAKRLSLARSLDDLDSAASSDGDYSGIQLQSCCSQSSLNS
NGSLPGAGSNRGAPEQRVASWSSCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYF
SHVPATDKKQLSQRAGEIYNSFLSSKATMPVNIDSQAQLADDVLTSPRPDMFKTQQLQIF
NLMKFDSYSRFLKSSLYQECMRAEMDGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKN
PQDVRKQRSGRSLNDDGRDESADKKRGFFSWSRNRSFGKGPKKKDIGDINLDYWGSNGRR
ESQGSLSSGTSLEMPISCSAGKIESDNRHSVGAWERAPKQCSVLLPDGSCSSVSLRPGAS
IREVLQELCQNISVNVAAVDLFLVGGDKPLVLDQDCMTLSSRDLRLEKRTLFRLDLVPIN
RSVGLKAKPTKPVTEVLRPVVAKYGLHLADLVAKISGETEPLDLGAPISSLDGLRVVLER
ADPCSVKDKSKSSSLKSHPTRSFSATGDERSAPKDFSVRPSGPDSALPRDKRKQKKINID
EAEEFFELLSRAQSTRANDQRGLLNKDDLVLPDFLRLTPPTSSLSVSSDLACSTPNSLKP
VRENGIPSRSPLTSSLRSESLDSSLSSSANGHSRRCLMPPPRHPTFGTHMSPILRPSDTR
PTLRTVEEDANADLTLVGEGDISSPTLLPPSPSPV
Download sequence
Identical sequences I3J059
ENSONIP00000002249 ENSONIP00000002249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]