SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3J2P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J2P1
Domain Number 1 Region: 50-77,194-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-58
Family G proteins 0.000000089
Further Details:      
 
Domain Number 2 Region: 81-201
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.27e-41
Family Transducin (alpha subunit), insertion domain 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3J2P1
Sequence length 374
Comment (tr|I3J2P1|I3J2P1_ORENI) Guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 {ECO:0000313|Ensembl:ENSONIP00000003131} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100703259 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
QIVVYSEYLKIVTTSDLEFEEEESMGAGASAEDKKSKELEKQLQEDADKESKTVKLLLLG
AGESGKSTIVKQMKILHQGGYTKEEQLEFRAIIYGNILQSALAIIRGMEMLGIDFGSSSG
QEDSQKLQNLSDSIEEGTMPPELADVIQKLWKDSGVQAAFERAAEYQLNDSAGYYLNEMD
RICKPEYMPTEQDVLRSRVKTTGIIEEQFSCKELHFRMFDVGGQRSERKKWIHCFEGVTC
IIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRFFALTSIVLFLNKKDLFEEKIKK
VHLSICFPDYDGPNTYDDASNYIKTQFLELNMKKGVKEIYSHLTCATDTKNVEIVFNAVT
DIIIKENLKDCGLF
Download sequence
Identical sequences I3J2P1
ENSONIP00000003131 ENSONIP00000003131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]