SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3J6L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J6L6
Domain Number 1 Region: 729-916
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.4e-44
Family SPRY domain 0.00066
Further Details:      
 
Domain Number 2 Region: 523-753
Classification Level Classification E-value
Superfamily RNI-like 4.51e-33
Family 28-residue LRR 0.0013
Further Details:      
 
Weak hits

Sequence:  I3J6L6
Domain Number - Region: 98-270
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00296
Family G proteins 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3J6L6
Sequence length 917
Comment (tr|I3J6L6|I3J6L6_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000004506} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MRQEELADCLQSSKNFQHELKSSLKKKFQCVFEGVARAGNPTLLNQIYTELYITEGGTAE
VNDEHEVRQIETASRKPDRPETTIRQEDIFKASLGREQPIRTVLTKGVAGIGKTVLTQKL
TLDWAEDKANQDIQFIFPFTFRELNVLKEEKFSLVELVHHFFTETKQAGICSFENVQVVF
IFDGLDECRLPLDFHKTTILTDPRKSTTVDVLLINLIRGNLLPSARLWITTRPAAANQIP
PECVDMVTEIRGFNDSQKEEYFRKRFRDEQQASRIFSHIKTSRSVHIMCHIPVFCWITAT
VLEDVLKTKEKRQLPKTLTEMYIHFLVVQVKVKKVKYDGGSETDPHWSPDSRKMVEALGK
LAFEQLQKGNLIFYESDLTECGIDITAASVYSGVFTQIFIEERGLYQDRVFCFVHLSVQE
FLAALHVHLSFINSGVNLLDKQQKSSHQSETDEYFYESAVDKALQSPNGHLDLLLRFLLG
LSLQTNQTLLRGLLTQTGSSSQTNQGTVQYIKKKLSENLSAEKNINLFHCLNELNDCSLV
EEIQQFLRSGRLSADKLSPAQWSALVFILLSSEKDLDVFDLKKYSASEEALLSLLPVVKA
SNKALLSGCDLSERSCDALSSLLSSPPVSLRELDLSNNNLQDSGVKLLSVGLKSPYWKLE
TLSLSGCLITEEGCASIASALSSNPSNLKQLDLSYNHLGDSGMKRLKDLHLRQDTLRVEP
AGVRWLTPGLRKYSCQLTINTNTVNRNLKLSDNNRKVTRVEEDQSYPDHPDRFDYQYPQL
LCTDGLTGRCYWEVEWKVEVQISVSYGTIRRKGDSKDCVFGRNDQSWSLFSSDVKGYSVV
HGNRETYLYPPSSSSSSSSSCVSNRVAVYVDCPAGTLSFYRVSSDTLIHLYTFNTTFTEP
LYPGFTVWFPGSSVTLC
Download sequence
Identical sequences I3J6L6
ENSONIP00000004506 ENSONIP00000004506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]