SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3J833 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J833
Domain Number 1 Region: 719-900
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-44
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 509-743
Classification Level Classification E-value
Superfamily RNI-like 9.55e-36
Family 28-residue LRR 0.00028
Further Details:      
 
Weak hits

Sequence:  I3J833
Domain Number - Region: 92-274
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000578
Family Nucleotide and nucleoside kinases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3J833
Sequence length 901
Comment (tr|I3J833|I3J833_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000005023} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MNHEELADRLQSKIPIEGFRPHFKSVLKKKFQCVFEGIAKAGNPTLLNEIYTELYITEGG
TAEVNDEHEVRQIETASWKTDRTETTIGQEDIFKNISGRDEPIRTVLTKGVAGIGKTVLT
QKYTLDWAEDKVNQDIQFIFPFTFRELNVLKEEKFSLVELVHHFFTETKEAGICSFEDFQ
VVFIFDGLDECRLPLDFHKTTILTDPRKSTSVDVLLINLIRGKLLPSARIWITTRPAAAN
QIPSYCVDMVTEVRGFTDPQKEEYFRKRFRDKKKTSRIISHIKTSRSLHIMCHIPVFCWI
TATVLEDVLETKEGGQLPKTLTEMYIHFLVVQAKVKKVKYDGGTETDPHWSPESRKMIES
LGKLAFDQLQKGNLIFYESDLTECGIDIRAASVYSGVFTQIFKEERGLYQDRVFCFIHLS
VQEFLAALHVHLTFINSGLNLLDEQQTTSQKSETRDPTFFYQSAVNKALQSPNGHLDLFL
XQTGSSSQTNQETVQYIKKKLSENLSAEKSINLFHCLNELNDRSLVEEIQQSLRSGSLST
DELSPAQWSALVFILLSSEKDLEVFDLKKYSASEEALLKLLPVVKASNKALLNGCNLTGR
SCKDLSSDLNFQSSSLRELDLSNNDLRDSGVRLFSAGLKNPHCKLESLSLSGCLITEEGC
TSLASALSSNPSHLRELDLSYNHPGDSGMKLLSAGLKDPGWKLDILRLEPAGVQWLTPGL
RKYSCQLTIDTNTVHTNLQLSDNNTKVTHVKEVQSYPDHPDRFDVRPQLLCENILAGRCY
WEVEWIGLVDISVSYRGIRRKGETYNCVFGYNDQSWSLDCIKDGPDSVCHNYSRTSISSS
SSSSSSVSNRVAVYVDCPAGTLSFYRVSSDTLIHLHTISTSFTEALYPGFWLDIGASVSL
C
Download sequence
Identical sequences I3J833
ENSONIP00000005023 ENSONIP00000005023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]