SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3J8T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J8T9
Domain Number 1 Region: 1325-1559
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-55
Family ABC transporter ATPase domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 2233-2464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.09e-51
Family ABC transporter ATPase domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3J8T9
Sequence length 2579
Comment (tr|I3J8T9|I3J8T9_ORENI) ATP-binding cassette, sub-family A (ABC1), member 12 {ECO:0000313|Ensembl:ENSONIP00000005279} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
VMAFFQQLKLLLWKNGLAVIRRPVWSLTLITWPLVIFIILAVTRYQFPPIVRETCYVGPR
NLPSTGLFPFLQTLMCNTDSSCHNTSRLVEPASSKSRRARFLFRESKCHRVKLHFNEPKY
CRVRIYFSELQYYKYDYCNAWSKSSALNTETKGTFNLRQKELIDSIFSQENLDNMLESAN
LLKRGICTVTLPMLNESSLDVFTNAVFTFCKTNNTVFEVSLYTVNQILEEWMLTQPEEMM
EVAWVTVTFLNQLQNDNLLWERLLALPQLFSDGSVDQMLRTLEDVLKHLQGVIKVVLGIF
ILIITEQVFSVLMKHVRHLWQTIMGPTNSFSSKMKWEKADEEQTVLPISCRSSMDLLKNA
VDMLPDALPYSSVIKNFTRALANESQENMMLVQQIIRTAGQLFQILPTDPQFKENLDLLR
VLRDLCKLVKLLSLVCMLEDTETVHLLMQSLNIESGQLCNTFLPSLEVIIEGLVMNTTSL
VDIFYQTVIGDPRSYNVHTDWYKDVIILLSKKLLLQLTRDLPIISVSSLNINSTSSRVMT
FGEMLKNKTDFVLDVQQYMDLDPATLDLLMNSTLPNNNLVILSWLLNLRHCPSTPLANME
EADLMNTFCSLSVEQWYTLSLLMTRHLNIEQVLYKMVLSDDIQTVVGIMVWVAEAITDMM
DKMLPAINQLQIYLNNIKNLNLTAKNQPHPVRQRRSATSSAGSFVTLSRALCSNGIKALF
GISKLPLVKESDPSITNNPQREEMIERFKIPRNATPFCMNMYLDMVNTTGGAIAWAFLKP
MLMGQILYTPDTPSTRAIIEKANATLQDFANVRQYSEDWIKSSKYLFTSANKLKKTLPML
QNSLGNPFVKNFIQRLTGIDVDRMQETLSSFSNMTLMLEKNKEIVDHINTLSTLMVDISS
CIKFDRYRGFDSADELNSAAQELAKNRDLYGSVIFKLPKDADSSRNKREATTSLPPEVSY
TIRMHMDNVMRTDRARNRFFVKESYISSRKTMRYNRGFIYLQESIDRAIIETQTGQKAKE
TAVQLQPFPYPCYHRDEYLEAISFVFPLMLMVAWVLFIADFVKKLVHERELRLHEYMKMM
GVNTLSHFFAWFVECFIYLLVTIIIMTLVLKHGKILPNSDSFLIFLYLCDYGLSILAFSY
LVSSFFDKTYIAGLSGSLLYILCFFPFIIVTALEGSLTLMQKSALGLFSPTCFSYASQYM
SRYEAQGEGIQWSNSYSSPIAGDTASFGWLCWLMLIDSILYFTIGAYIRTVFPGKYGIPA
PWYFPFKLSFWADLCCVRPKKNTAKGLLFSNIMQNDQLAFSNDKGKGKSALSTKTGEDFS
ELPVGVALHGLTKTYGDQAAIQNLNVSFYEGHVTSLLGHNGAGKTTTMSLLTGLFAPSSG
TIEVYGRDMQTNIENVRRELGVCMQYDVLFDHMTTKEHLLLYGQIKAPHWSDRELHEQVR
TILEDTGMYAHRHKRVGTLSGGMKRKLSISIAFIGGSRVVVLDEPTTGVDPCSRRNIWDI
VIQHKKNRTIIMSTHHLDEAEVLSDRIAFLEKGGLKCCGSPFYLKEKLGQGYKLTLTKKV
QKTEDKQIDSAEVKAFVQAHVPEARLKEAQGNDLVYSLPPFNSSNASSYRSLLTALDSNL
DALQLGGYGISDTTLEEVFLQLTHGQTEAKAEDGLPSISETVSDTISIDSLSLDDSDSST
SFSDRIIKKELTSSSTVTGMALAWQQMSAILIKRFHHSRRDWKGLISQILLPVLFVVFAM
SLGSIKSDVQHYPELQLSPALYKIGPSYSFFSNQNPNSQRLADTMMSFPGMDTTCLDKRD
NLDCTRNTNKWSSSGNSSKGFNICKCTQKEQICDKDNYQPPHTEIPSSQIVYDLNGINVE
NYLVSTANDFIRNRYGGFAFGMPLPADLKMDITAVPENRTLSKVWFNPEGHHTMPAYLNS
LNNFILRANLPADKDPRKYAISVYSQPYFGRADDEDVVVQGLLHILVAMCVLTGFSITTA
SFAIYEVTEHQKGSKRLQHIAGISESFYWIVNFIYDMVIYLVPVAATVAVIAAFQIPAFT
ERQNLGAVTLLLVLFGFSTFPWMYLFAGIFRDAEMAFISYVCINLFISVNTILTTCILYF
LGQISMRNPEAIQEIFQKLSYAFLIFPQFSFGNGLMELARGDIEVQILSGYGVDAYKNPF
STEGLGWMFISSIIQGLVFFTLRLLINKSLMRKVRRLICYIKTVPQAAYDDDQDEDVVSE
HLRVASGAASSDILQVNRLTKIYQHLSKKVHAVKNLSVGIPAGECFGLLGVNGAGKTTTF
KMLTGDVSPTDGTAQIKDWDGRLVDIMECRKQGINIGYCPQVDALDDLLTGEEHLYFYAR
IRGVSKWETDRLVNYLLKRLQLNYHRNIITDGYSCGTRRKLSTALALIGNPQILLLDEPS
SGMDPRTKRHLWKIISEEVKGKCAVVLTSHSMEECEALCSRLAIMVKGQFRCLGSLQHIK
NRFGSGFTVKMYLAEASCDVGKITSFMQRRFPSTYLKDQHSTVVEYHVPFAPGGLADIFD
QLESNKNALQIKHFSVSQTTLDEVFINFAMGKIGMETIPIDAEDENECVSIHTKSDLNS
Download sequence
Identical sequences I3J8T9
ENSONIP00000005279 ENSONIP00000005279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]