SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3J9D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3J9D4
Domain Number 1 Region: 14-124
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.01e-19
Family G proteins 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3J9D4
Sequence length 125
Comment (tr|I3J9D4|I3J9D4_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000005474} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MGVIVSHIFSRFFSKHPVRILMVGLDAAGKTTLLYKLKLEYQSETIVKVGSIVLLQLQED
ELKGVAVLVFANKQDLPRAMSVSDIIEALSLKGVSQPWSIQPSCAVSGTGVVEGLDWLSN
EILKQ
Download sequence
Identical sequences I3J9D4
ENSONIP00000005474 ENSONIP00000005474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]