SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JEG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JEG5
Domain Number 1 Region: 162-446
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.07e-67
Family Tandem AAA-ATPase domain 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JEG5
Sequence length 480
Comment (tr|I3JEG5|I3JEG5_ORENI) DEAD (Asp-Glu-Ala-Asp) box helicase 6 {ECO:0000313|Ensembl:ENSONIP00000007256} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=ddx6 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSTARTENPVILGLPNQNGQLRGSVKPAGAPGGGGGGPQQLNQMKGTINNGNSQPAPTTN
AVIKPGDDWKKNLKLPPKDMRMKTSDVTATKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
EESIPIALSGRDILARAKNGTGKSGAYLIPLLERIDLKKDCIQALVIVPTRELALQVSQI
CIQVSKHMGGVKVMATTGGTNLRDDIMRLDETVHVVIATPGRILDLIKKGVAKVGQVQMI
VLDEADKLLSQDFVVMMEEILGFLPKQRQILLYSATFPLSVQKFMNSHLQKPYEINLMEE
LTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFY
IHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLGETYLHRIG
RSGRFGHLGLAINLITYDDRFNLKGIEEQLGTEIKPIPGIIDKSLYVAEYHSESGEEVKP
Download sequence
Identical sequences I3JEG5
ENSONIP00000007256 ENSONIP00000007256 XP_003450212.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]