SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JKE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JKE4
Domain Number 1 Region: 503-817
Classification Level Classification E-value
Superfamily RNI-like 2.92e-54
Family 28-residue LRR 0.00011
Further Details:      
 
Weak hits

Sequence:  I3JKE4
Domain Number - Region: 75-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0664
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JKE4
Sequence length 817
Comment (tr|I3JKE4|I3JKE4_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000009338} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
LKNEFECVFEGIAKAGNPTLLNEIYTELYITEGGTAEVNDEHEVRQIETASRKPDRPETT
ITQEDIFKASPGRDEPIRTVLTKGVAGIGKTILTQKYTLDWAEDKANQDIQFIFPFTFRE
LNVLKEENFSLVELVHHFFTETKEAGICSFEDFQVVFIFDGLDECRLPLDFHKTTILTDP
RKSTALDVLLINLIRGKLLPSAHLWITTRPAAANQIPPKCVGRVTEIRGFTDPQKEEYFY
KRFRDEEQASRIISQIKTSRSLHIMCHIPVFCWITATVLEDVLETREGGQLPKTLTEMYI
HFLVVQAKVKKVKYDGGAETDPHWSPESRKMIESLGKLAFDQLQKENLIFYESDLTECGI
DIRAASVYSGVFTQIFKEERGLYQDKVFCFIHLSVQEFLAALYVHLTFIKSGVNLLEEQT
TSMWSTSSDKPKLQSLHQSAVNKALQSPNGHLDLFLRFLLGLSLQTNQTLLRGLLTQTGS
SSQIHQETVQYIKNRLSWTLSAEKSINLIHCLNELNDRSLVEEIQQYRSSGSLSTGKLSP
AQCSALTFMLLSSEEDLDEFDFKKYSSSEEALLRMLPVVKASRKVLLSSCNVSEEGCENL
LSVVSSQSCSVRELDLSTNSLKASAVKLLSAAVESPHTKLNILRLNICELSEEICEALSS
VLSSQSSSLTELDLSIRKLQGSGVKLLSAGLQSLNCKLNTLRLSGCNLSERSCLALSSVL
SSQSSSLRVLDLSNSDLQDSGVKLLSAGLKGSQCAVETLSLSGCLITEEGCTSLASALSS
NPSHLRELDLSYNHPGDSGMKPLSAGLKDPGWRLDTL
Download sequence
Identical sequences I3JKE4
ENSONIP00000009338 ENSONIP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]