SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JKV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JKV4
Domain Number 1 Region: 139-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-102
Family RecA protein-like (ATPase-domain) 0.000000000129
Further Details:      
 
Domain Number 2 Region: 424-551
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 3.14e-45
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000078
Further Details:      
 
Domain Number 3 Region: 53-137
Classification Level Classification E-value
Superfamily N-terminal domain of alpha and beta subunits of F1 ATP synthase 2.62e-27
Family N-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JKV4
Sequence length 552
Comment (tr|I3JKV4|I3JKV4_ORENI) ATP synthase subunit alpha {ECO:0000256|RuleBase:RU003551} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=atp5a1 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MLSVRVAAALARNLPRRAGLVSKNVAAACVGAKNLHTSSPWLQKKTGTAEVSSILEEKIM
GADTSSDLEETGRVLSIGDGIARVYGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPLGSKVRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDNFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGHLDKMEPSKITKFEKAFLQHILSQHQDLLANIKADGKISEASDAKL
KQIVLNFLSSFE
Download sequence
Identical sequences I3JKV4
XP_003451515.1.78416 ENSONIP00000009498 ENSONIP00000009498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]