SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JMA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JMA9
Domain Number 1 Region: 451-765
Classification Level Classification E-value
Superfamily RNI-like 1.08e-46
Family 28-residue LRR 0.00039
Further Details:      
 
Domain Number 2 Region: 776-950
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-45
Family SPRY domain 0.0015
Further Details:      
 
Weak hits

Sequence:  I3JMA9
Domain Number - Region: 75-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0138
Family Nitrogenase iron protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JMA9
Sequence length 956
Comment (tr|I3JMA9|I3JMA9_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000010003} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
LKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGTAEVNDEHEVRQIETASRKPDRPERT
IRQEDIFKGSPGRDEPIRTVLTKGVSGIGKTVLIQKYSLDWAEDKANQDIQFIFPFTFRE
LNVLKEEKFSLVELVHHFFTETKEAGICRFEDFQVVFIFDGLDECRLPLDFXMVTEVRGF
TDPQKEEYFRKRFGDEEQASKIISHIKSSRSLHIMCHIPVFCWITATVLEDVLKTREGGQ
LPKTLTDIYIHFLVVQAKVKKVKYDGRAETDPHWSPESKKTIESLGKLAFEQLQQGNLIF
YESDLTECGIDIRAASVYSGVFTQIFMYQDKVFCFIHLSVQEFLAALHVHLTFINSGLNL
LEEQQTTSKKSDLFGKKRHFQSFYRSAVDKALQSPNGHLDLFLRFLLGLSLQTNQTLLRG
LLTQTRSNSRTNRKTLQYIKTKLSEKLSSEKTINLFHCLNELNDRSLVEEIQQSLSSGSL
STDELSPAQWSALVFILLSSEKDLDVFDLKKYSASEEALLRLLPVVKACNKALFLFLFFY
LAINCLRTHSKKNLKFSHDLVTESNSCSADRIVKVLSDPGHHSLRRSFFRLSACNLSETS
CEALSSVLSSQSSSLRELDASNNNLQDPGVKLLSVGLQSQHCTLETLRLSGCDLTKKSCE
SLSSILSSQPCSLRVLDLSDNNLQDSGVEILSAGVRSPYCKLETLSLSGCLITEEGCTSL
ATALSSNPSYLRELDLSYNHPGNSGMKLLSAGRKDPRWRLDILKVEPAGVRWLTPGLRKY
SCQLTIDTNTVHTNLQLSDNNRKVTHAEEVQSYPDHPDRFDVYEQLLCRDGLTGRCYWEV
EWRGDVEISVSSRKIRRKGDSTDCLFGWNDQSWSLICSGDRPRSVRQNKTEKSISSSSYS
VCNRVAVYVNCPAGTLSFYRVSSDTLIHLHTVNTTFTETLYPGFWFRSPGSSVCLC
Download sequence
Identical sequences I3JMA9
ENSONIP00000010003 ENSONIP00000010003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]