SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JMJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JMJ3
Domain Number 1 Region: 709-880
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-46
Family SPRY domain 0.00088
Further Details:      
 
Weak hits

Sequence:  I3JMJ3
Domain Number - Region: 78-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00797
Family Nucleotide and nucleoside kinases 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JMJ3
Sequence length 886
Comment (tr|I3JMJ3|I3JMJ3_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000010087} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
KSTLKKKFQCVFEGIAKAGNPTLLNQIYTELYITEGGTAEVNDEHEVRQIETASRKPDRP
ETTIRQEDIFKASPGRDEPIRTVLTKGVAGIGKTVLTQKYTLDWAEDKANQDFQFIFPFT
FSELNVLKEEKFSLVELVHHFFTETKEAGICSFEDFQVVFIFDGLDECRLPLDFHKTTIL
TDPRKSTSVDVLLINLIRGNLLPSAHLWITTRPAAANQIQPDCVGMVTEVRGFTDPQKEE
YFRKRFRDEEQASRIISHIKTSRSLHIMCHIPVFCWITATVLEDVLETREGGQLPKTLTE
MYIHFLVVQAKVKKVKYDGGVETDPHWSPESRKMIESLGKLAFDQLQKGNLIFYESDLTE
CGIDIRAASVYSGVFTQIFKEERGLYQDKVFCFIHLSVQWSALVFILLSSEIQPDVFDLQ
KYSASEEALLRLLPVVKASNKAVPSQLYLYSMFNIHLVSAKVLNRGTIQLNKRISGEVTH
CLHRLEDMIPSPHVQAKSSIIAACKPKVRGQLMLQAGNEARKKDHCTQSQKKISLYLFCL
LVFIFIMANIMMSLLILTSTFSLSQRRKRYIFCVTSSQRWLNAGGVLTEKIVGRWKEYFK
ESKELGKKNHLVLFKLLEDVSSLILEASKGQMVESPRFKCSGSIPPKRNKGPPDDPLPNH
MSRDGRQLVFAHSGHKWLLSLLFQTICPLCPKSRISLNHQQFDPHMDSNSCQLTIDTNTV
NTNLQLSDNNRKVTHVEEVQSYPDHPDRFDVCPQLLCRDGLTGRCYWEVEWRGDVYISVS
YRSIRRKGGSNDCLFGYNDQSWSLYCSNNGPDSIRHNYRSRYVSSSSSSSVSNRAAVYVD
CPAGTLSFYRVSSDTLIHLHTFNTTFTQTLYPGFRLWFPGASVSLC
Download sequence
Identical sequences I3JMJ3
ENSONIP00000010087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]