SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JS98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JS98
Domain Number 1 Region: 13-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.97e-19
Family G proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JS98
Sequence length 224
Comment (tr|I3JS98|I3JS98_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000011743} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
CRGGREKGEKEEKTDDLRIVLFGKTWVGKSTLGDIIMGNTETFTSKDLSKDRTQKSHSTV
EGQKVVVVDTPGLFKSGKHEDELVKEIKRSIDLASPGPHVFLLVLRFGMITSEELEVLEV
FERTFGRRALAYTTVVFTHKNEEYEANIQETMIESKDFRELLERCQWRYFAFNIKDKSPA
QVTELLKKITPMGKDYFYTPEMLQEAGKPEEQEEKPKTEQAGVR
Download sequence
Identical sequences I3JS98
ENSONIP00000011743 ENSONIP00000011743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]