SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JU66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JU66
Domain Number 1 Region: 36-63,182-376
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-62
Family G proteins 0.0000000163
Further Details:      
 
Domain Number 2 Region: 67-188
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 7.59e-35
Family Transducin (alpha subunit), insertion domain 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JU66
Sequence length 378
Comment (tr|I3JU66|I3JU66_ORENI) G protein subunit alpha L {ECO:0000313|Ensembl:ENSONIP00000012411} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=GNAL OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MGCLGGKTDEERLDEKAKREANKKIEKQLQRERQTYKATHRLLLLGAGESGKSTIVKQMR
ILHVDGFNAEEKQQKVQDIRKNVKDAIVTIVSAMTILAPPIPLGNPGNQFRADYIKSIGP
LSDFEYTEEFFEHAQKLWEDDGVKACFERANEYQLIDCAQYFLDRLDSVRRPDYSPTDQD
LLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMV
IREDNSTNRLRESLDLFRSIWTNRFLKTISVILFLNKQDVLAEKILAGKSKLEDYFPEYN
NYQLPADAVPDNDEDPKVMRAKFFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVF
NDCRDIIQRMHLRQYELL
Download sequence
Identical sequences I3JU66
XP_003459474.1.78416 XP_019210467.1.78416 ENSONIP00000012411 ENSONIP00000012411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]