SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3JUS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JUS3
Domain Number 1 Region: 248-377,415-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.83e-39
Family Hemopexin-like domain 0.00078
Further Details:      
 
Domain Number 2 Region: 64-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 23-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000012
Family Somatomedin B domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JUS3
Sequence length 482
Comment (tr|I3JUS3|I3JUS3_ORENI) Proteoglycan 4b {ECO:0000313|Ensembl:ENSONIP00000012618} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=prg4 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
RMSSTLLCTLIFLACALTFSGAQTSCRGRCGGEYYRGYRCQCDYNCLSYGECCNDFESQC
TTKNSCKGRCGESFKRGRLCSCDSDCIKYNQCCSDYKNHCDAQGSLDQDECDIPTLTLPA
CPSAACTVRQYNRSMQRMHSSCNNVNDNKAKVDPLGEISTEATPTTARTPSDNDDLVSTT
AEALSDSTKKSPKSAADHTSSEPMSTLIPSVEPSSSTSSPQLDTQTPAVTIMDAVFPSDE
PDDNNDTNLCSGRPVSGVTTLRNGTMVVFRGHYFWLLDSNRVPGPPRGITQVWGVPSPID
TVFTRCNCQGKTYIFKGSQYWRFENDALDHGYPKVITTGFDGLRGHITAALSVPQYKSRA
ESVYFFKRGGFVQKYSYHAGVGPTCPKKRRKTAVQNKANTFHSYLTCSDSGPAITIRTSW
RGFPPAITAAVSVPTTTEPEGYKYFVFSGSKSYNVRLDGERPVIAPPTASSSPQSNNFIR
CL
Download sequence
Identical sequences I3JUS3
ENSONIP00000012618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]