SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3K598 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K598
Domain Number 1 Region: 929-1198
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.61e-69
Family Tandem AAA-ATPase domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 680-927
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.6e-54
Family Tandem AAA-ATPase domain 0.0000695
Further Details:      
 
Domain Number 3 Region: 431-478,505-551
Classification Level Classification E-value
Superfamily Chromo domain-like 6.41e-18
Family Chromo domain 0.017
Further Details:      
 
Domain Number 4 Region: 308-381
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.51e-17
Family PHD domain 0.002
Further Details:      
 
Domain Number 5 Region: 575-644
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000175
Family Chromo domain 0.0066
Further Details:      
 
Weak hits

Sequence:  I3K598
Domain Number - Region: 149-187
Classification Level Classification E-value
Superfamily HMG-box 0.037
Family HMG-box 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K598
Sequence length 1907
Comment (tr|I3K598|I3K598_ORENI) Chromodomain helicase DNA binding protein 4b {ECO:0000313|Ensembl:ENSONIP00000016293} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=chd4 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
PPPSPTEEQEPEDAVSDVDEVPKSKKKKKAKKSSRENRSSKRQRPIREELPVSSPEHLLG
VEAAERDADEGGMRSESEGSDYAPGRKKKKRSSSAKDKKNSKSKRKDPEPEDDEDDDDDC
QPKSSTQLLEAWGMKDIDHVFTQEDYSSLTNYKAFSQFVRPLIAAKNPKIAVSKMMTLMM
AKWREFSTNNPLKGCATANAALAAANVAAAVENMVVAAPIAPPAAPAPPLRKAKTKEGKG
PNARRRSKPTSKPPPKPKPKKVAPLKIKLGGLNSKRKRSSSDEDEPDVDSDFDDGSFSVS
DGSSRSSRPKKKPKSAKKKKKVETEDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMV
CLDPDMEKAPEGKWSCPHCEKEGIQWEARDDLSEAEGEDDDDRRDEGMEEEDDHHIEFCR
VCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWICPRCKCPPMKGKVQKVLTWRWGEA
PAPMPVPRPADLPADAPDPPPLAGRREREFFVKWCNMSYWHCSWVQELQLELNCQVMFRN
YQRKTDMDEPPPADFGGEGDDDKSTKRKNKDPLFVHMEEEFCRYGVKMEWLMIHRVLNHS
VDKKNNVHYLIKWRDLPYDQSTWESEDMDIPEYDTYKQTYWNHRELMMGEEGRPGKKLKK
TVKVKKAERPPANPVVDPTIKFDRQPDYLDSTGGTLHPYQLEGLNWLRFSWAQATDTILA
DEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYIGDK
DSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACL
VVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGF
LEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSSMQKKYYKFIL
TRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAANEAPKLPNGMYEGTSLTKASG
KLMLLQKMMRRLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNLRQEAID
RFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVM
IYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKMGSMSKQELDDILKFGTEELFKDE
VGDVSGDNKEDDSSVIHYDDQAIDRLLDRNQDATDDTELQSMNEYLSSFKVAQYVVKDED
DEEEEVEREVIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRTRKPVNYNDGSQED
RDWQEDQSDNQSDYSVASEEGDEDFDERTEANARRPNRKGLRNDRDKPLPPLLARVGGNI
EVLGFNARQRKAFLNAVMRYGMPPQDAFTNQWLVRDLRGKSEKEFKAYVSLFMRHLCEPG
ADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWSMPWMAELEENKRAA
ALAAGEDPKTPSTGTPADTQPNTPVPVHITEDLSKSEDKEDMKKEGEDGKAAKKADDPEI
IEIPDESEKSPVLDKKEEADSAAEKEDREKETDGVEGKEKEAEDMSKEKEEKSVEKDASA
EIKGEGSESKMDLVENFFLFLEQKEEKDSVKPDESGKLQNGENAKDGGTAAPVVNVSEEK
KKATKQRFMFNIADGGFTELHSLWQNEERAATVTKKTFEIWHRRHDYWLLAGIIQHGYAR
WQDVQNDVRFAILNEPFKGEMSRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMT
EDPAHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANAVLHKVLKQLEELLSDMKADV
TRLPATIARIPPVAVRLQMSERNILSRLASRGPEVTAQNQSQTAQQM
Download sequence
Identical sequences I3K598
ENSONIP00000016293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]