SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3K6R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K6R4
Domain Number 1 Region: 357-504,556-965
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-222
Family Nitrogenase iron protein-like 0.000000000138
Further Details:      
 
Domain Number 2 Region: 78-184
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 6.33e-16
Family Tetrahydrofolate dehydrogenase/cyclohydrolase 0.00066
Further Details:      
 
Domain Number 3 Region: 187-292
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000512
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3K6R4
Sequence length 974
Comment (tr|I3K6R4|I3K6R4_ORENI) Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like {ECO:0000313|Ensembl:ENSONIP00000016809} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=mthfd1l OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MKLALIRSAYSSLRAHPVRPGSRFTGFSRRCLPIGITSSRLSLRAASATSSTGTNPKLTG
NFGVQSQKGDESDYDNHVRKVVQSTREAIVTLQKRNPAIQPLLAILQAGEDDSMLEINKK
MAVKIGLNITQICLAKECNEDDIVEELLKLNDDPKVHGIYLHLPRGSITSRVLNTLKPEK
DIEGISDLNMGRLIRGDLSKGFVPPLASAVLDLLENHDAPLEGKTVLLVGGEGPLQLAVQ
CLIERSGMVTLKSHWSSKTLQAQVMQADAVVLLDVGNMYVPPTWIRPGAAIIYSKPALEK
DESAFGLSSKSGLESLTAAYRTQNVVRSCSRWLKGQEYRPWHLRSLKLQPLTPVPSDLEI
SRAQIPKPVDQLAEEIGLLPEELEAYGRSKAKVRLSVLERLQSQPNGKYILVAGITPTPL
GEGKSTVTVGLVQALSAHLKLNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEEFNLHL
TGDIHAITAANNLVAAAIDARMLHEATQSDKALFNRLVPSVNGVRKFSPIQISRLQRLGI
RKTDPASLTPEEINAFVRLDLDPSKITWQRVVDTNDRFLRKITVGQASSEKGQIRETGFD
IAVASEIMAILALADSLEDMKNRLARMVVGTSCSGQPITAEDLGVSGALAVLMKDAIKPT
LMQTLEGTPVFVHAGPFANIAHGNSSVLADKLALKLVGQDGFVVTEAGFGADIGMEKFFN
IKCRASGLRPSVVVLVATVRALKMHGGGPNVSAGAPLPREYTDENLSLVAGGCCSNLKKQ
IQIAHLFGVPVVVAVNVFKTDTQAEIDLVCQIAKDCGASDALPCNHWAQGGRGSSELAQA
VKEAASKPSDFQFLYNTEMPIVEKIRTIAQRVYGADDIELSPEAKSKTDYYHQQGYGSLP
ICMAKTHLSLSHMPDKKGAPTGFVLPIRDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYD
IDLDPVTEEITGLF
Download sequence
Identical sequences I3K6R4
XP_003449927.1.78416 ENSONIP00000016809 ENSONIP00000016809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]