SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KF10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KF10
Domain Number 1 Region: 366-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-55
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 195-304
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-24
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 106-211
Classification Level Classification E-value
Superfamily PDZ domain-like 7.49e-21
Family PDZ domain 0.0021
Further Details:      
 
Domain Number 4 Region: 63-113
Classification Level Classification E-value
Superfamily L27 domain 0.000000000447
Family L27 domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KF10
Sequence length 571
Comment (tr|I3KF10|I3KF10_ORENI) Membrane protein, palmitoylated 4a (MAGUK p55 subfamily member 4) {ECO:0000313|Ensembl:ENSONIP00000019705} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100693564 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
SGVSEVLSSVVKDVDQAVSRNINGAQLLHELLSAPWLCALLKIYECLLKFQRLTPSPVLP
YAAGLSHEVMTAILKAQNPSAPARELCSLLSSPHIQALLSSHDSVAQSDYEPVLPPLPDE
IPEDEEAMRIVCLVKNNQPLGATIRKDEATGDIYIARVIHGGLADRSALLHPGDLLVEVN
GNPVVGLEPEQVIHILANSQGTILFKVIPNPSQASNSQTLVCMRAMVDYCPLQDSSIPCP
DAGMAFSRGDLLQVVDQSDGQWWQARKLPCATSCAGLIPSASMLKSKQREQWWCQPLQVH
TCIRPRTIIAELFVTWIFLTGFRRSFRVWKRTSYRKRRQSCTTCSPNTNALSTPYEEVVL
YQRPPQENHRLIILVGASGVGVNELRKRLIKLNPSTFQGPVPHTTRSIRAGEQNDREYHF
VTKELFEYMVCNHRFVEYGESKGQLYGISTDAIDEVLKRGRMCIIDAEPHSIQLLRTKKF
KPYVIFIKPPSPDRLRQTRRDARIITNYAINRVFSEEDFVELEETSKLIEAKYKQFFDSV
LVNDDLQDACIELCSIIQQAQDEPQWIPVSW
Download sequence
Identical sequences I3KF10
ENSONIP00000019705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]