SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KHB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KHB4
Domain Number 1 Region: 203-394
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.77e-38
Family G proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KHB4
Sequence length 732
Comment (tr|I3KHB4|I3KHB4_ORENI) Nucleolar GTP-binding protein 2 {ECO:0000256|RuleBase:RU364023} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=gnl2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MVKTRYKGKSSINPSTSSSNPDRAKGAGGNNMRDRATIKRLNMYRQKQRCNSRGKVVKPL
QYQSTVAPGTVARVEPNIKWFANTRVIKQSSLQKFQEEMEAVKKDPYRVVMRQSKLPMSL
LHDRVKAHNSKVHILDTEGFENTFGPKAQRKRPSLVVGDVKDLVEQAEASALSYNAENDK
DLVTEDTGVRAEAREEIFKKGQSKRIWGELYKVIDSSDVIIQVLDARDPMGTRSKSIETY
LKKEKSWKHLIFVLNKCDLVPTWVTKRWVAVLSQEYPTLAFHASLTNSFGKGSLIQLLRQ
FGKLHTDKKQISVGFIGYPNVGKSSIINTLRSKKVCNVAPLAGETKVWQYITLMRRIFLI
DCPGVVYPSEDSESDIVLKGVVQVEKIKNPEEHIGAVLERAKPEYIQKTYRIPTWNCADD
FLEKLAFRTGKLLKGGEPDLATVSKMVLNDWQRGRIPFFVKPPGPEGDQEDEKPLPVAGP
SEVVEHVEKEQPDNPDAISEEREEEQQRQKEQVQKILANVRQNFGKISVAPEFSEEDLVP
VDMPDLDMSDFSGSDDEEDEGTEENEGKEEDATSVEPVDEGTDISEPTTSQTEKTNGSKS
SREVIRELDVKIAKYKQFLDRAKSNRFSAIRIPKALSDKVFTDIKTKQSAATKQAQKKAP
NQRGKKRKAEEGEDLAQPNRLTSKQRRAMDRAQRTKKVGVRYYETHNVKNKNKNKKIPAS
GTEGQNTKKSKH
Download sequence
Identical sequences I3KHB4
ENSONIP00000020509 ENSONIP00000020509 XP_013130030.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]