SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KI29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KI29
Domain Number 1 Region: 50-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-16
Family G proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KI29
Sequence length 240
Comment (tr|I3KI29|I3KI29_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000020774} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100710013 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MGSLFSKAQDRSNVTKDRQLVAANMSCWAHGLHCIRRQHTDEAKTGRHTGTTVNFVLLGA
AGTGKSASGNTILGKKHFISRPSSKPVTTKCQNGQTKINDLHVRVIDTPDIFDDEIGSSV
RNKHMNRCKELCESGPCVYVLVMHVSRFTDGERDIMETLEEDFGSEVSGRTIILFTRGND
LQQAGMGLEDFLHSCQPDLKKMVEKCGNRCVLFENNKSGSDQVEKLMEKVNTILEDQKSL
Download sequence
Identical sequences I3KI29
ENSONIP00000020774 ENSONIP00000020774 XP_003457375.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]