SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KIE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KIE0
Domain Number 1 Region: 222-355,388-431
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.59e-30
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 2 Region: 43-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000262
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000837
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KIE0
Sequence length 457
Comment (tr|I3KIE0|I3KIE0_ORENI) Proteoglycan 4a {ECO:0000313|Ensembl:ENSONIP00000020885} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
SSGSCVGRCGEVFNRGRQCKCDFSCLQHKECCQDFEATCTIAQSCQGRCGEVFRRGKLCE
CDPLCVLYNTCCHDYKLNCSKYPQLLLTDATVPLSPESYRRKCIDACRKRKSQKNRKSSN
SVSSMPVGLLPVIVPSSHSRAPYSPAPGSSLPINNAPSLGSGAPVSPMAHGAVGSKLDAQ
LVLSPGGAASSMLSQGSRPSTLQDVLQGLGHGGSEGPGTDVDLCSDSPINGLTALINGTI
LVFKGKLFWSVDPISRSVGQPQSITDTLGISSPIDTIFTRANCKGNTYIIKGDQYWRLDG
NMVMEPGYPKPLVSEFPGLTGHISAALAVPATRGKPETVYFFKNGEILQSFTFPPDSIPS
CSKKPRNSMNTALKRHQRAGVLLGGEINIKVSLKGFPTPITSALSMTSPQGSGRYHHYVF
SGPLFFNIQISGDLPVLAKPDPSASAANSIRVWLRCP
Download sequence
Identical sequences I3KIE0
ENSONIP00000020885 ENSONIP00000020885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]