SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KJK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3KJK5
Domain Number - Region: 102-195
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0523
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KJK5
Sequence length 254
Comment (tr|I3KJK5|I3KJK5_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000021300} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100712494 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MLQSSDILGHERPLVIRVSFATCVLATVCLPLLGLITCVFISSVFHFEDATGTHCQVPNY
LPSISASISLSPECHIWRFCIGLHSAPRLLVAFTYFKFYKARFATRFPESSLSCLNLGFS
ISENLGLLLLTYVSSTETYFVHKEGFVLFIVSSLIYMLITCRLWKSIKKYSLNPEDAKSH
HWKVRFLLLNVSFCAFAGFFYWKHNMYCESGSYTFFALFEYLVVFSNMAFHLTAVWDFKS
REVMLISSSEDKDF
Download sequence
Identical sequences I3KJK5
XP_003455981.1.78416 ENSONIP00000021300 ENSONIP00000021300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]