SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KMY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KMY3
Domain Number 1 Region: 41-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.33e-29
Family G proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KMY3
Sequence length 313
Comment (tr|I3KMY3|I3KMY3_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000022478} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100690069 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAGSLPHPADQHVDASLTPDTQRDVIHVQEEAEADADDLHLRMVLVGRTGVGKSASGNTI
LGRKAFKSASSFASVTSECQKETGEVDGQTLAVVDTPGLFDITVSEEEVKEQFVRCISFA
APGPHVFLIVVQIGRFTKEEQETVKILQEIFGKEAADYTMVLFTHGDDVDNEANIDKLIN
GNQRLHGFISQCGGRYHVFKNRSEDVSQVRELLEKINTMVQSNGGKCYTNEMLQEAERAV
REETERIQREDTEMVEEKEAAGAGGQEEKKKKFLKSVGIGAGAGSVLGPVGAALGAAVGA
AVAAAKEKKCVIL
Download sequence
Identical sequences I3KMY3
ENSONIP00000022478 XP_005461829.2.78416 ENSONIP00000022478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]