SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KNM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KNM5
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.5e-52
Family G proteins 0.0000000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KNM5
Sequence length 186
Comment (tr|I3KNM5|I3KNM5_ORENI) RAP1B, member of RAS oncogene family {ECO:0000313|Ensembl:ENSONIP00000022720} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100707998 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG
TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDL
EVERVVAKESGIGLARQWNSCAFLETSAKSKINVNEIFYDLVRQINRKSPVPGKTRKKST
SSATLL
Download sequence
Identical sequences I3KNM5
ENSONIP00000022720 ENSONIP00000022720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]