SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KRI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KRI4
Domain Number 1 Region: 14-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.23e-45
Family G proteins 0.0000204
Further Details:      
 
Domain Number 2 Region: 193-232
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000017
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KRI4
Sequence length 292
Comment (tr|I3KRI4|I3KRI4_ORENI) RAB40C, member RAS oncogene family {ECO:0000313|Ensembl:ENSONIP00000023729} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=RAB40C OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MRGMMGTQSSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSVESPYAYSSGIDYKTTTI
LLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNGWSFDGIDRWIREIDEHA
PGVPRILVGNRLHLAFKRQVPTEQARAYAEKNSMTFFEVSPLCNFNVIESFTELSRIVLM
RHGMEKFWRPNRVFSLQDLCCRSIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMM
HGRSYSVANSAASGGSSGGSKANSLKRSKSFRPPQSPPKSSSLSPKGNCKIS
Download sequence
Identical sequences I3KRI4
ENSONIP00000023729 XP_003453881.2.78416 ENSONIP00000023729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]