SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KS91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KS91
Domain Number 1 Region: 13-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.77e-60
Family Ankyrin repeat 0.0000735
Further Details:      
 
Domain Number 2 Region: 470-519
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000916
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KS91
Sequence length 525
Comment (tr|I3KS91|I3KS91_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000023987} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100711123 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MDFTECYRDTVSSVATAARSGCRRRLRTLIQRGCSVDCRDNRGWTPLHEAAAAGSKACVQ
EILSAVRARSSSCSRVYVNHLTHEGESACYLAAQRGHLSVVRLLLKAHADINQLTNDLSC
PLYEAVSHGHTDVVELLVSKGAEVNRIHTESSWTCLHQAAYKGHTEIVRILVNKCNLEAV
DDYRISPLFVAAQYGQRGCLEILVNAGANVNTQAVDLSTPLFIASQEGHQACVDFLLDHG
ADPNMVCSHDWPQFAIHAAAQFGHIGILRSLIAVTDRACDRGESMVSPVYVAVNSDQPKS
VELLLREGYSPDAQDCSHTHGLLSPLSLALYRTPQKPYRCFDIKISFSELVKLLIAAGAR
LNEEDWIYALATDEADLLQLIFEHRWIPRPEELNEMLCVALSQVHFAGCWLPLLLKAGLE
PSLLLQPHMLEQADSQVLNYLLEFVNWSTLSPHLKHILDRKVAEKSWDPHPCFDSVPCLS
HICRLQVRALLGPDILMRTNVVQQLPVPNRLHDFLKFRDIPEASY
Download sequence
Identical sequences I3KS91
ENSONIP00000023987 ENSONIP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]