SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3KU29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KU29
Domain Number 1 Region: 6-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.16e-106
Family Motor proteins 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KU29
Sequence length 826
Comment (tr|I3KU29|I3KU29_ORENI) Kinesin family member 6 {ECO:0000313|Ensembl:ENSONIP00000024625} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=kif6 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MVKQTIQIFARIKPTKKNVAVYSVDNENQTGASLEFFVPKDLADGFVNNKRECYNFRFQK
VFDRVAKQEEIFENIAKPVADSVLAGYNGTVFAYGQTGSGKTFTITGGAERYSDRGIIPR
TLSYLYERFSQDSSMVYTTHISYLEIYNEMGYDLLDSRHEASRLEDLPKVMIMEDQDQNI
HLRNLSLQQSASEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTVHLCRREPGSATMR
RSKLHLVDLAGSDRVSKTGLNGQLLTDAKYINLSLHYLEQVIIALSEKNRSHIPYRNSML
TSVLRDSLGGNCMTTMIATMAVERRNLEESISTCRFAQRVAVIKNEAILNEELDPALLIA
SLKREILSLKEELAMVTGEQRDDRLTPEEIQKLEELVKAYLDDPDSDVTLSLGPDMRKIQ
YCFSLLKVIIWDKKGGKKRCSDDKATPAATVREEEIQHSHQSAGEVAKLKEMLGQRDNEI
SILVKMLKKEKKRAQDAAAQLAHITNSQSQSTSSVSTVELSQEGSMETISADHRGRAIQY
MKRGPKLSMGKQEAFEIFIRDHEDHLTIEDNKSLLKQRSAEARELGEELNEARNRITELK
KQLDVRRRQRAAYGVMENHTGSEEEFDPVEENLCKHIEEEKKGYKSIVGRLKALRTEIEH
LQLLLERSKVKLQKDFHKWWSQEASSLQESESEAAAQSHTGTLNKTIQPSSPRALGFGAP
ALSSTVRDSPAGRHRNPDPSISSVQELRSFTPESKPPVPAVPAWQNKPVNRKVTDFTPSS
EWKTLTSATVSSSSIPLTGDQKTDADILAFIRARQNLVSRAGKHKQ
Download sequence
Identical sequences I3KU29
ENSONIP00000024625 XP_005477555.1.78416 ENSONIP00000024625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]