SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3L259 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3L259
Domain Number - Region: 27-75
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0107
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3L259
Sequence length 86
Comment (tr|I3L259|I3L259_HUMAN) Active breakpoint cluster region-related protein {ECO:0000313|Ensembl:ENSP00000459406} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ABR OC=Catarrhini; Hominidae; Homo.
Sequence
MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIY
INQLEALLLPMKPLKATATTSQPVLT
Download sequence
Identical sequences A0A2J8JKK1 A0A2J8SNR5 I3L259
ENSP00000459406 ENSP00000459406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]