SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I3L3W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3L3W9
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000000126
Family ALDH-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3L3W9
Sequence length 74
Comment (tr|I3L3W9|I3L3W9_HUMAN) Aldehyde dehydrogenase, dimeric NADP-preferring {ECO:0000313|Ensembl:ENSP00000460792} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALDH3A1 OC=Catarrhini; Hominidae; Homo.
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYM
Download sequence
Identical sequences I3L3W9
ENSP00000460792 ENSP00000460792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]